Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

2,416 – 2,430 of 1,816,563 results

2,416

PHF10 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate	Unconjugated
Target Species	Human
Host Species	Rabbit
Applications	Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype	IgG
Antigen	PHF10
Regulatory Status	RUO
Purification Method	Affinity Purified
Gene Alias	BAF45a, BAF45APHD zinc finger protein XAP135, BRG1-associated factor 45a, FLJ10975, MGC111009, PHD finger protein 10, XAP135BRG1-associated factor, 45-KD, A
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	55274
Classification	Polyclonal
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: GRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVI
Primary or Secondary	Primary

2,417

CD64 Mouse anti-Human, APC, Clone: 10.1, BD

Mouse Monoclonal Antibody

Pricing & Availability

2,418

Human CD163 Alexa Fluor™ 488-conjugated Antibody, R&D Systems™

Mouse Monoclonal Antibody has been used in 2 publications

Pricing & Availability
Specifications

Content And Storage	Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 degreesC as supplied.
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor 488
Applications	Flow Cytometry
Form	Purified
Isotype	IgG1
Gene Accession No.	Q86VB7
Antigen	CD163
Gene Symbols	CD163
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Dilution	Flow Cytometry 5 uL/10^6 cells
Gene Alias	CD_antigen: CD163, CD163, CD163 molecule, GHI/61, HbSR, Hemoglobin scavenger receptor, M130, macrophage-associated antigen, MM130, RM3/1, SCARI1, scavenger receptor cysteine-rich type 1 protein M130, sCD163, Soluble CD163
Product Type	Antibody
Gene ID (Entrez)	9332
Formulation	Supplied in a saline solution containing BSA and Sodium Azide. with Sodium Azide
Immunogen	Mouse myeloma cell line NS0-derived recombinant human CD163 Gly46-Ser1050 Accession # Q86VB7
Classification	Monoclonal
Primary or Secondary	Primary
Test Specificity	Detects human CD163 in direct ELISAs and Western blots.
Clone	215927

2,419

Human CD31/PECAM-1 Antibody, R&D Systems™

Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 6 months, -20°C to -70°C under sterile conditions after reconstitution.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Multiplex Immunofluorescence,Immunocytochemistry,Immunohistochemistry,Western Blot
Form	Purified
Isotype	IgG
Gene Accession No.	P16284
Antigen	CD31/PECAM-1
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Gene Alias	adhesion molecule, CD31, CD31 antigen, CD31/EndoCAM, EndoCAM, FLJ34100, FLJ58394, GPIIA', PECA1, PECAM1, PECAM-1, PECAM-1, CD31/EndoCAM, platelet endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1, platelet/endothelial cell adhesion molecule
Gene ID (Entrez)	5175
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Immunogen	Chinese Hamster Ovary cell line, CHO-derived human CD31/PECAM-1, Gln28-Lys601, Accession # P16284
Classification	Monoclonal
Reconstitution	Reconstitute lyophilized material at 0.2 mg/mL in sterile PBS. For liquid material, refer to CoA for concentration.
Primary or Secondary	Primary
Clone	3179D

2,420

IL-17RC Antibody (309822), DyLight 405, R&D Systems™

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Antigen	IL-17RC
Regulatory Status	RUO
Content And Storage	Store at 4°C in the dark.
Target Species	Human
Host Species	Mouse
Conjugate	DyLight 405
Applications	CyTOF,Flow Cytometry
Form	Purified
Gene ID (Entrez)	84818
Classification	Monoclonal
Immunogen	Mouse myeloma cell line NS0-derived recombinant human IL-17 RC, Leu21-Ala454, Accession # NP_116121
Primary or Secondary	Primary
Clone	309822

2,421

Ki-67 Mouse, Alexa Fluor 647, Clone: B56, BD

Mouse Monoclonal Antibody

Pricing & Availability

2,422

Human Ki67/MKI67 Alexa Fluor 647-conjugated Antibody, R&D Systems™

Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 degreesC as supplied.
Target Species	Human
Host Species	Rabbit
Conjugate	Alexa Fluor 647
Applications	Flow Cytometry (Intracellular Staining)
Form	Supernatant
Isotype	IgG
Gene Accession No.	P46013
Antigen	Ki67/MKI67
Regulatory Status	RUO
Purification Method	Protein A or G purified from cell culture supernatant
Dilution	Intracellular Staining by Flow Cytometry 0.25-1 ug/10^6 cells
Gene Alias	antigen identified by monoclonal Ki-67, antigen KI-67, Antigen Ki67, Ki67, Ki-67, KIA, Marker Of Proliferation Ki-67, MIB-, MIB-1, MKI67, PPP1R105, Proliferation Marker Protein Ki-67, proliferation-related Ki-67 antigen, Protein Phosphatase 1, Regulatory Subunit 105, TSG126
Product Type	Antibody
Gene ID (Entrez)	4288
Formulation	Supplied 0.2 mg/mL in a saline solution containing BSA and Sodium Azide.
Immunogen	Human Ki-67/MKI67 synthetic peptide Accession # P46013
Classification	Monoclonal
Primary or Secondary	Primary
Test Specificity	Detects human Ki-67/MKI67 in direct ELISAs.
Clone	1297A

2,423

Ki-67 Monoclonal Antibody (SolA15), APC, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse,Rat,Canine,Monkey,Cynomolgus Monkey
Host Species	Rat
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	E9PVX6, P46013
Concentration	0.2 mg/mL
Antigen	Ki-67
Gene Symbols	Mki67
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	antigen identified by monoclonal antibody Ki 67; antigen identified by monoclonal antibody Ki-67; Antigen identified by monoclonal antibody Ki-67 homolog; Antigen KI-67; Antigen KI-67 homolog; antigen KI-67; proliferation marker protein Ki-67; antigen KI-67-like; cb31; D630048A14Rik; I79_022666; Ki67; Ki-67; KIA; LOW QUALITY PROTEIN: proliferation marker protein Ki-67; marker of proliferation Ki-67; MIB-; MIB-1; Mki67; PPP1R105; Proliferation marker protein Ki-67; proliferation-related Ki-67 antigen; protein phosphatase 1, regulatory subunit 105; RP11-380J17.2; sb:cb31; si:ch211-250b22.7; unnamed protein product; wu:fa11g09; wu:fb57a07; wu:fi14e05
Gene	Mki67
Product Type	Antibody
Gene ID (Entrez)	100686578, 102135895, 17345, 291234, 4288
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	SolA15

2,424

Invitrogen™ PLA2R1 Monoclonal Antibody (CL0485)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	Q13018
Isotype	IgG1
Concentration	1 mg/mL
Antigen	PLA2R1
Gene Symbols	Pla2r1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	180 kDa secretory phospholipase A2 receptor; CLEC13C; C-type lectin domain family 13 member C; mannose receptor, C type 2; Mrc2; M-type receptor; phospholipase A2 receptor 1; phospholipase A2 receptor 1, 180kD; phospholipase A2 receptor 1, 180kDa; phospholipase A2, group IB, pancreas, receptor; Pla2g1br; PLA2G1R; PLA2-I receptor; PLA2IR; Pla2r; Pla2-r; PLA2R1; Secretory phospholipase A2 receptor; Soluble PLA2-R; Soluble secretory phospholipase A2 receptor
Gene	Pla2r1
Product Type	Antibody
Gene ID (Entrez)	22925
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein fragment of Human PLA2R1 (Product #RP-90366)
Classification	Monoclonal
Primary or Secondary	Primary
Clone	CL0485

2,425

Coronavirus Mouse anti-Human, Clone: 541-8F, MilliporeSigma™

Mouse Monoclonal Antibody

Pricing & Availability

2,426

Mouse CCL2/JE/MCP-1 Antibody, R&D Systems™

Goat Polyclonal Antibody has been used in 43 publications

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Human,Mouse,Rat,Transgenic Mouse
Host Species	Goat
Conjugate	Unconjugated
Applications	Bioassay,Dot Blot,ELISA Capture (Matched Antibody Pair),ELISA Development,ELISA Development (Capture),Flow Cytometry,Immunocytochemistry,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),In vivo Assay,Luminex,Neutralization,Western Blot
Isotype	IgG
Gene Accession No.	Q5SVU3
Concentration	LYOPH
Antigen	CCL2/JE/MCP-1
Gene Symbols	Ccl2
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 0.1 ug/mL, Neutralization 0.5-2.5 ug/mL, ELISA Capture (Matched Antibody Pair) 0.2-0.8 ug/mL
Gene Alias	C-C motif chemokine ligand 2, CCL2, GDCF-2, HC11, HSMCR30, MCAF, Mcp1, MCP-1, SCYA2, SMC-CF
Product Type	Antibody
Gene ID (Entrez)	6347
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen	E. coli-derived recombinant mouse CCL2/JE/MCP-1 Gln24-Arg96 Accession # Q5SVU3
Classification	Polyclonal
Reconstitution	Reconstitute at 0.2 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects mouse CCL2/JE/MCP-1 in ELISAs and Western blots.

2,427

Invitrogen™ Rhodopsin Monoclonal Antibody (1D4)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 1 month. For long term storage store at -20°C
Target Species	Human,Mouse,Rat,Bovine
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry,Western Blot
Form	Liquid
Gene Accession No.	P02699, P08100, P15409, P51489
Isotype	IgG1
Antigen	Rhodopsin
Gene Symbols	RHO
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	CSNBAD1; L opsin; Long Wavelength Sensitive opsin; LWS opsin; MGC138309; MGC138311; Noerg1; OPN 2; Opn2; Ops; opsin 2; opsin 2, rod pigment; opsin-2; Red Opsin; retinal rod opsin pigment rh1.1; Rh; RH1; rh1.1; rho; rho protein; rhodopsin; rhodopsin (opsin 2, rod pigment) (retinitis pigmentosa 4, autosomal dominant); Rhodopsin (retinitis pigmentosa 4, autosomal dominant); rhodopsin-like-1.1 rod opsin; Rod Opsin; RP 4; RP4; seven transmembrane light receptor; unknown opsin-like protein; wu:fi06d11; zfo2; zfrho
Gene	RHO
Product Type	Antibody
Gene ID (Entrez)	212541, 24717, 509933, 6010
Formulation	HEPES with 0.15M NaCl, 50% glycerol, 100μg/mL BSA and no preservative; pH 7.5
Immunogen	Bovine rhodopsin.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	1D4

2,428

Fibroblast Activation Protein alpha/FAP Antibody (427819), PE/Cy5.5, R&D Systems™

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Antigen	Fibroblast Activation Protein alpha/FAP
Regulatory Status	RUO
Content And Storage	Store at 4C in the dark. Do not freeze.
Target Species	Human
Host Species	Mouse
Conjugate	PE-Cyanine5.5
Applications	Flow Cytometry
Form	Purified
Gene ID (Entrez)	2191
Classification	Monoclonal
Immunogen	S. frugiperda insect ovarian cell line Sf 21-derived recombinant human Fibroblast Activation Protein alpha/FAP, Leu26-Asp760, Accession # Q12884
Primary or Secondary	Primary
Clone	427819

2,429

c-Abl Antibody (8E9), R&D Systems™

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C. Do not freeze.
Conjugate	Unconjugated
Target Species	Human,Mouse
Host Species	Mouse
Applications	Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form	Purified
Isotype	IgG1
Antigen	c-Abl
Regulatory Status	RUO
Purification Method	Protein G purified
Gene Alias	Abelson murine leukemia viral oncogene homolog 1, ABL, c-ABL, c-abl oncogene 1, non-receptor tyrosine kinase, c-abl oncogene 1, receptor tyrosine kinase, EC 2.7.10, EC 2.7.10.2, JTK7bcr/abl, p150bcr/c-abl oncogene protein, Proto-oncogene c-Abl, proto-oncogene tyrosine-protein kinase ABL1, tyrosine-protein kinase ABL1, v-abl, v-abl Abelson murine leukemia viral oncogene homolog 1
Formulation	PBS (pH 7.4), 0.2% BSA
Gene ID (Entrez)	25
Classification	Monoclonal
Immunogen	Recombinant Abl protein
Primary or Secondary	Primary
Clone	8E9

2,430

Human SOX10 Antibody, R&D Systems™

Goat Polyclonal Antibody has been used in 32 publications

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Chicken,Human,Mouse,Rat,Rhesus Macaque,Transgenic Mouse,Xenograft
Host Species	Goat
Conjugate	Unconjugated
Applications	FACS,Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,In Situ Hybridization (ISH),Proximity Ligation Assay,Western Blot
Isotype	IgG
Gene Accession No.	P56693
Concentration	LYOPH
Antigen	SOX10
Gene Symbols	SOX10
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 0.1 ug/mL, Immunohistochemistry 5-15 ug/mL, Immunocytochemistry 5-15 ug/mL
Gene Alias	DOM, MGC15649, PCWH, SRY (sex determining region Y)-box 10, SRY-related HMG-box gene 10, transcription factor SOX-10, WS4, WS4C, WS4mouse, human homolog of
Product Type	Antibody
Gene ID (Entrez)	6663
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen	E. coli-derived recombinant human SOX10 Met1-Ala118 Accession # P56693
Classification	Polyclonal
Reconstitution	Reconstitute at 0.2 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects human SOX10 in direct ELISAs and Western blots.

Primary Antibodies

Filtered Search Results

Narrow Results

Human CD163 Alexa Fluor™ 488-conjugated Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human Ki67/MKI67 Alexa Fluor 647-conjugated Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PLA2R1 Monoclonal Antibody (CL0485) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Mouse CCL2/JE/MCP-1 Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Rhodopsin Monoclonal Antibody (1D4) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human SOX10 Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human CD163 Alexa Fluor™ 488-conjugated Antibody, R&D Systems™

Human Ki67/MKI67 Alexa Fluor 647-conjugated Antibody, R&D Systems™

Invitrogen™ PLA2R1 Monoclonal Antibody (CL0485)

Mouse CCL2/JE/MCP-1 Antibody, R&D Systems™

Invitrogen™ Rhodopsin Monoclonal Antibody (1D4)

Human SOX10 Antibody, R&D Systems™